Recombinant Human ID3
Cat.No. : | ID3-28926TH |
Product Overview : | Recombinant full length Human ID3 with a proprietary tag; Predicted MWt 39.09. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 119 amino acids |
Description : | The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. |
Molecular Weight : | 39.090kDa inclusive of tags |
Tissue specificity : | Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH |
Sequence Similarities : | Contains 1 basic helix-loop-helix (bHLH) domain. |
Gene Name | ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein [ Homo sapiens ] |
Official Symbol | ID3 |
Synonyms | ID3; inhibitor of DNA binding 3, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-3; bHLHb25; HEIR 1; |
Gene ID | 3399 |
mRNA Refseq | NM_002167 |
Protein Refseq | NP_002158 |
MIM | 600277 |
Uniprot ID | Q02535 |
Chromosome Location | 1p36.13-p36.12 |
Pathway | Adipogenesis, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | protein domain specific binding; transcription corepressor activity; transcription factor binding; |
◆ Recombinant Proteins | ||
ID3-1176HFL | Recombinant Full Length Human ID3 Protein, C-Flag-tagged | +Inquiry |
ID3-4407M | Recombinant Mouse ID3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ID3-2983R | Recombinant Rat ID3 Protein | +Inquiry |
ID3-2638R | Recombinant Rat ID3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ID3-6158C | Recombinant Chicken ID3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ID3-5310HCL | Recombinant Human ID3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ID3 Products
Required fields are marked with *
My Review for All ID3 Products
Required fields are marked with *
0
Inquiry Basket