Recombinant Human ID3

Cat.No. : ID3-28926TH
Product Overview : Recombinant full length Human ID3 with a proprietary tag; Predicted MWt 39.09.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 119 amino acids
Description : The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts.
Molecular Weight : 39.090kDa inclusive of tags
Tissue specificity : Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
Sequence Similarities : Contains 1 basic helix-loop-helix (bHLH) domain.
Gene Name ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein [ Homo sapiens ]
Official Symbol ID3
Synonyms ID3; inhibitor of DNA binding 3, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-3; bHLHb25; HEIR 1;
Gene ID 3399
mRNA Refseq NM_002167
Protein Refseq NP_002158
MIM 600277
Uniprot ID Q02535
Chromosome Location 1p36.13-p36.12
Pathway Adipogenesis, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function protein domain specific binding; transcription corepressor activity; transcription factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ID3 Products

Required fields are marked with *

My Review for All ID3 Products

Required fields are marked with *

0
cart-icon
0
compare icon