Recombinant Human IGFBP1 protein, His-tagged
| Cat.No. : | IGFBP1-7433H |
| Product Overview : | Recombinant Human IGFBP1 protein(81-259 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 81-259 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSIPWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | IGFBP1 insulin-like growth factor binding protein 1 [ Homo sapiens ] |
| Official Symbol | IGFBP1 |
| Synonyms | IGFBP1; insulin-like growth factor binding protein 1; IBP1; insulin-like growth factor-binding protein 1; AFBP; alpha pregnancy associated endometrial globulin; amniotic fluid binding protein; binding protein 25; binding protein 26; binding protein 28; growth hormone independent binding protein; hIGFBP 1; IGF binding protein 1; IGF BP25; placental protein 12; PP12; IBP-1; IGFBP-1; binding protein-25; binding protein-26; binding protein-28; IGF-binding protein 1; growth hormone independent-binding protein; alpha-pregnancy-associated endometrial globulin; IGF-BP25; hIGFBP-1; |
| Gene ID | 3484 |
| mRNA Refseq | NM_000596 |
| Protein Refseq | NP_000587 |
| MIM | 146730 |
| UniProt ID | P08833 |
| ◆ Recombinant Proteins | ||
| IGFBP1-5048H | Active Recombinant Human Insulin-Like Growth Factor Binding Protein 1 | +Inquiry |
| Igfbp1-3082M | Recombinant Mouse Igfbp1 protein, His-tagged | +Inquiry |
| IGFBP1-2489H | Recombinant Human IGFBP1 Protein (Ala26-Asn259), C-His tagged | +Inquiry |
| IGFBP1-821H | Recombinant Human IGFBP1 protein, His & GST-tagged | +Inquiry |
| IGFBP1-39H | Recombinant Human IGFBP1, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGFBP1-1482CCL | Recombinant Cynomolgus IGFBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFBP1 Products
Required fields are marked with *
My Review for All IGFBP1 Products
Required fields are marked with *
