Recombinant Human IGFBP1 protein, His-tagged

• Cat.No.: IGFBP1-7433H
• Product Overview: Recombinant Human IGFBP1 protein(81-259 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 81-259 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: GLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSIPWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: IGFBP1 insulin-like growth factor binding protein 1 [ Homo sapiens ]
• Official Symbol: IGFBP1
• Synonyms: IGFBP1; insulin-like growth factor binding protein 1; IBP1; insulin-like growth factor-binding protein 1; AFBP; alpha pregnancy associated endometrial globulin; amniotic fluid binding protein; binding protein 25; binding protein 26; binding protein 28; growth hormone independent binding protein; hIGFBP 1; IGF binding protein 1; IGF BP25; placental protein 12; PP12; IBP-1; IGFBP-1; binding protein-25; binding protein-26; binding protein-28; IGF-binding protein 1; growth hormone independent-binding protein; alpha-pregnancy-associated endometrial globulin; IGF-BP25; hIGFBP-1
• Gene ID: 3484
• mRNA Refseq: NM_000596
• Protein Refseq: NP_000587
• MIM: 146730
• UniProt ID: P08833