Recombinant Human IGHV4-39 Protein, His-tagged
| Cat.No. : | IGHV4-39-107H |
| Product Overview : | Recombinant Human IGHV4-39 Protein, fused to His-tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response; defense response to other organism; and phagocytosis. Predicted to be located in extracellular region and plasma membrane. Predicted to be part of immunoglobulin complex, circulating. Predicted to be active in external side of plasma membrane. |
| Form : | PBS, pH 7.0. |
| Molecular Mass : | 26.9 kDa |
| AA Sequence : | MQVQLQESGPGLVKPSETLSLTCTVSGGSISSTSYYWGWIRQPPGKGLEWIGSISYSGSTYYNPSLKSRVTISVDTSKNQFSLKLTSVTAADTAVYYCARILWFGEYLGDYWGQGTLVTVSSGGGGSGGGGSGGGGSELHMTQSPGTLSLSPGERATLSCRASQSVSNYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYHCQQYYSTPWTFGQGTKVDIKHHHHHHH |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.34 mg/ml |
| Gene Name | IGHV4-39 immunoglobulin heavy variable 4-39 [ Homo sapiens (human) ] |
| Official Symbol | IGHV4-39 |
| Synonyms | VH; IGHV439 |
| Gene ID | 28394 |
| UniProt ID | P01824 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGHV4-39 Products
Required fields are marked with *
My Review for All IGHV4-39 Products
Required fields are marked with *
Recently Viewed
