Recombinant Human IGLL5 Protein (36-214 aa), His-tagged
Cat.No. : | IGLL5-1636H |
Product Overview : | Recombinant Human IGLL5 Protein (36-214 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 36-214 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.3 kDa |
AA Sequence : | HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | IGLL5 immunoglobulin lambda like polypeptide 5 [ Homo sapiens (human) ] |
Official Symbol | IGLL5 |
Synonyms | IGL; IGLV; VL-MAR; |
Gene ID | 100423062 |
mRNA Refseq | NM_001178126 |
Protein Refseq | NP_001171597 |
UniProt ID | B9A064 |
◆ Recombinant Proteins | ||
IGLL5-1636H | Recombinant Human IGLL5 Protein (36-214 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGLL5 Products
Required fields are marked with *
My Review for All IGLL5 Products
Required fields are marked with *
0
Inquiry Basket