Recombinant Human IGLL5 Protein (36-214 aa), His-tagged

• Cat.No.: IGLL5-1636H
• Product Overview: Recombinant Human IGLL5 Protein (36-214 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 36-214 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.3 kDa
• AA Sequence: HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: IGLL5 immunoglobulin lambda like polypeptide 5 [ Homo sapiens (human) ]
• Official Symbol: IGLL5
• Synonyms: IGL; IGLV; VL-MAR
• Gene ID: 100423062
• mRNA Refseq: NM_001178126
• Protein Refseq: NP_001171597
• UniProt ID: B9A064