Recombinant Human IGSF5 protein, His-tagged
Cat.No. : | IGSF5-3580H |
Product Overview : | Recombinant Human IGSF5 protein(1-266 aa), fused to His tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-266 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MGQKERSTADTLPDLEEWKSAAGLRWWQTAVVDGSGSGNEVIEGPQNARVLKGSQARFNCTVSQGWKLIMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVEPSDSGNIRCSLQNSRLHGSAYLTVQVMGELFIPSVNLVVAENEPCEVTCLPSHWTRLPDISWELGLLVSHSSYYFVPEPSDLQSAVSILALTPQSNGTLTCVATWKSLKARKSATVNLTVIRCPQDTGGGINIPGVLSSLPSLGFSLPTWGK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IGSF5 immunoglobulin superfamily, member 5 [ Homo sapiens ] |
Official Symbol | IGSF5 |
Synonyms | IGSF5; immunoglobulin superfamily, member 5; immunoglobulin superfamily member 5; JAM4; junctional adhesion molecule 4; JAM-4; immunoglobulin superfamily 5 like; GSF5; |
Gene ID | 150084 |
mRNA Refseq | NM_001080444 |
Protein Refseq | NP_001073913 |
MIM | 610638 |
UniProt ID | Q9NSI5 |
◆ Recombinant Proteins | ||
IGSF5-3580H | Recombinant Human IGSF5 protein, His-tagged | +Inquiry |
IGSF5-3016R | Recombinant Rat IGSF5 Protein | +Inquiry |
IGSF5-2671R | Recombinant Rat IGSF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGSF5 Products
Required fields are marked with *
My Review for All IGSF5 Products
Required fields are marked with *