Recombinant Human IL6 Protein, GMP Grade, Animal-Free
| Cat.No. : | IL6-33HG |
| Product Overview : | GMP Recombinant Human IL6 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, IL-6 has diverse biological functions. |
| AA Sequence : | PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Purity : | ≥ 98% by SDS-PAGE gel and HPLC analyses. |
| Gene Name | IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens (human) ] |
| Official Symbol | IL6 |
| Synonyms | IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6; |
| Gene ID | 3569 |
| mRNA Refseq | NM_000600 |
| Protein Refseq | NP_000591 |
| MIM | 147620 |
| UniProt ID | P05231 |
| ◆ Native Proteins | ||
| IL6-01SFL | Recombinant Full Length Sheep IL6 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
