Recombinant Human INTU Protein, GST-tagged
Cat.No. : | INTU-5083H |
Product Overview : | Human INTU full-length ORF ( ENSP00000296461, 1 a.a. - 408 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This locus includes two alternatively spliced read-through transcript variants which align to the INS gene in the 5' region and to the IGF2 gene in the 3' region. One transcript is predicted to encode a protein which shares the N-terminus with the INS protein but has a distinct and longer C-terminus, whereas the other transcript is a candidate for nonsense-mediated decay (NMD). The transcripts are imprinted and are paternally expressed in the limb and eye. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 72.6 kDa |
AA Sequence : | MASVASCDSRPSSDELPGDPSSQEEDEDYDFEDRVSDSGSYSSASSDYDDLEPEWLDSVQKNGELFYLELSEDEEESLLPETPTVNHVRFSENEIIIEDDYKERKKYEPKLKQFTKILRRKRLLPKRCNKKNSNDNGPVSILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVVHGLLPGGSAMKSGQVLIGDVLVAVNDVDVTTENIERVLSCIPGPMQVKLTFENAYDVKRETSHPRQKKTQSNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTLCDMLENVTGTQVTSSSLLLNGKQIHVAYWKESDKLLLIGLPAEEIELPSSAHTHGERN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | INTU inturned planar cell polarity protein [ Homo sapiens (human) ] |
Official Symbol | INTU |
Synonyms | INTU; inturned planar cell polarity protein; INT; PDZD6; PDZK6; protein inturned; PDZ domain containing 6; PDZ domain-containing protein 6; homolog of inturned; inturned planar cell polarity effector homolog |
Gene ID | 27152 |
mRNA Refseq | NM_015693 |
Protein Refseq | NP_056508 |
MIM | 610621 |
UniProt ID | Q9ULD6 |
◆ Recombinant Proteins | ||
INTU-2443H | Recombinant Human INTU Protein, MYC/DDK-tagged | +Inquiry |
INTU-5083H | Recombinant Human INTU Protein, GST-tagged | +Inquiry |
INTU-4574M | Recombinant Mouse INTU Protein, His (Fc)-Avi-tagged | +Inquiry |
INTU-8254M | Recombinant Mouse INTU Protein | +Inquiry |
Intu-3559M | Recombinant Mouse Intu Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INTU-1327HCL | Recombinant Human INTU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INTU Products
Required fields are marked with *
My Review for All INTU Products
Required fields are marked with *