Recombinant Human IPO7 Protein, GST-tagged
Cat.No. : | IPO7-5076H |
Product Overview : | Human IPO7 partial ORF ( NP_006382.1, 950 a.a. - 1038 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. Similar to importin-beta, this protein prevents the activation of Rans GTPase by RanGAP1 and inhibits nucleotide exchange on RanGTP, and also binds directly to nuclear pore complexes where it competes for binding sites with importin-beta and transportin. This protein has a Ran-dependent transport cycle and it can cross the nuclear envelope rapidly and in both directions. At least four importin beta-like transport receptors, namely importin beta itself, transportin, RanBP5 and RanBP7, directly bind and import ribosomal proteins. [provided by RefSeq |
Molecular Mass : | 35.53 kDa |
AA Sequence : | DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IPO7 importin 7 [ Homo sapiens ] |
Official Symbol | IPO7 |
Synonyms | IPO7; importin 7; RAN binding protein 7 , RANBP7; importin-7; Imp7; RAN-binding protein 7; RANBP7; FLJ14581; MGC138673; |
Gene ID | 10527 |
mRNA Refseq | NM_006391 |
Protein Refseq | NP_006382 |
MIM | 605586 |
UniProt ID | O95373 |
◆ Recombinant Proteins | ||
IPO7-2336H | Recombinant Human IPO7 Protein, His-tagged | +Inquiry |
IPO7-11148Z | Recombinant Zebrafish IPO7 | +Inquiry |
IPO7-8265M | Recombinant Mouse IPO7 Protein | +Inquiry |
IPO7-5076H | Recombinant Human IPO7 Protein, GST-tagged | +Inquiry |
IPO7-4582M | Recombinant Mouse IPO7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IPO7 Products
Required fields are marked with *
My Review for All IPO7 Products
Required fields are marked with *
0
Inquiry Basket