Recombinant Human IPO7 Protein, GST-tagged

Cat.No. : IPO7-5076H
Product Overview : Human IPO7 partial ORF ( NP_006382.1, 950 a.a. - 1038 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. Similar to importin-beta, this protein prevents the activation of Rans GTPase by RanGAP1 and inhibits nucleotide exchange on RanGTP, and also binds directly to nuclear pore complexes where it competes for binding sites with importin-beta and transportin. This protein has a Ran-dependent transport cycle and it can cross the nuclear envelope rapidly and in both directions. At least four importin beta-like transport receptors, namely importin beta itself, transportin, RanBP5 and RanBP7, directly bind and import ribosomal proteins. [provided by RefSeq
Molecular Mass : 35.53 kDa
AA Sequence : DDEDNPVDEYQIFKAIFQTIQNRNPVWYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IPO7 importin 7 [ Homo sapiens ]
Official Symbol IPO7
Synonyms IPO7; importin 7; RAN binding protein 7 , RANBP7; importin-7; Imp7; RAN-binding protein 7; RANBP7; FLJ14581; MGC138673;
Gene ID 10527
mRNA Refseq NM_006391
Protein Refseq NP_006382
MIM 605586
UniProt ID O95373

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IPO7 Products

Required fields are marked with *

My Review for All IPO7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon