Recombinant Human IQCF2 Protein, GST-tagged
Cat.No. : | IQCF2-5065H |
Product Overview : | Human IQCF2 full-length ORF (AAH40047.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | IQCF2 (IQ Motif Containing F2) is a Protein Coding gene. An important paralog of this gene is IQCF1. |
Molecular Mass : | 44.44 kDa |
AA Sequence : | MRVRFCTKGNLILVIIEDVEESIEWKTLQKKKQQKIKEKLRIRTKAAVKIQAWWRGTLVRRTLLHAALRAWIIQCWWRMTLSRVLEKKRQAALIAYATRERAVIKLQSLVRMWRVRWRYCQVLNAIYIIQGHWQCHNCQTCALLQGHCVVTATHLQFHIEIINS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IQCF2 IQ motif containing F2 [ Homo sapiens (human) ] |
Official Symbol | IQCF2 |
Synonyms | IQCF2; IQ motif containing F2; IQ domain-containing protein F2 |
Gene ID | 389123 |
mRNA Refseq | NM_203424 |
Protein Refseq | NP_982248 |
UniProt ID | Q8IXL9 |
◆ Recombinant Proteins | ||
IQCF2-5711HF | Recombinant Full Length Human IQCF2 Protein, GST-tagged | +Inquiry |
IQCF2-5065H | Recombinant Human IQCF2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IQCF2 Products
Required fields are marked with *
My Review for All IQCF2 Products
Required fields are marked with *
0
Inquiry Basket