Recombinant Human IQCF2 Protein, GST-tagged

Cat.No. : IQCF2-5065H
Product Overview : Human IQCF2 full-length ORF (AAH40047.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : IQCF2 (IQ Motif Containing F2) is a Protein Coding gene. An important paralog of this gene is IQCF1.
Molecular Mass : 44.44 kDa
AA Sequence : MRVRFCTKGNLILVIIEDVEESIEWKTLQKKKQQKIKEKLRIRTKAAVKIQAWWRGTLVRRTLLHAALRAWIIQCWWRMTLSRVLEKKRQAALIAYATRERAVIKLQSLVRMWRVRWRYCQVLNAIYIIQGHWQCHNCQTCALLQGHCVVTATHLQFHIEIINS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IQCF2 IQ motif containing F2 [ Homo sapiens (human) ]
Official Symbol IQCF2
Synonyms IQCF2; IQ motif containing F2; IQ domain-containing protein F2
Gene ID 389123
mRNA Refseq NM_203424
Protein Refseq NP_982248
UniProt ID Q8IXL9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IQCF2 Products

Required fields are marked with *

My Review for All IQCF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon