Recombinant Human IQGAP1 protein, GST-tagged

Cat.No. : IQGAP1-23H
Product Overview : Recombinant Human IQGAP1(611 a.a. - 710 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 611-710 a.a.
Description : This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKW VKHWVKGGYYYYHNLETQEGGWDEP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name IQGAP1 IQ motif containing GTPase activating protein 1 [ Homo sapiens ]
Official Symbol IQGAP1
Synonyms IQGAP1; IQ motif containing GTPase activating protein 1; ras GTPase-activating-like protein IQGAP1; HUMORFA01; KIAA0051; p195; RasGAP like with IQ motifs; SAR1; RasGAP-like with IQ motifs;
Gene ID 8826
mRNA Refseq NM_003870
Protein Refseq NP_003861
MIM 603379
UniProt ID P46940
Chromosome Location 15q26.1
Pathway Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; C-MYB transcription factor network, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem;
Function GTPase activator activity; GTPase inhibitor activity; Rac GTPase binding; Ras GTPase activator activity; calmodulin binding; protein binding; protein phosphatase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IQGAP1 Products

Required fields are marked with *

My Review for All IQGAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon