Recombinant Human IQGAP1 protein, GST-tagged
| Cat.No. : | IQGAP1-23H |
| Product Overview : | Recombinant Human IQGAP1(611 a.a. - 710 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 611-710 a.a. |
| Description : | This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKW VKHWVKGGYYYYHNLETQEGGWDEP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | IQGAP1 IQ motif containing GTPase activating protein 1 [ Homo sapiens ] |
| Official Symbol | IQGAP1 |
| Synonyms | IQGAP1; IQ motif containing GTPase activating protein 1; ras GTPase-activating-like protein IQGAP1; HUMORFA01; KIAA0051; p195; RasGAP like with IQ motifs; SAR1; RasGAP-like with IQ motifs; |
| Gene ID | 8826 |
| mRNA Refseq | NM_003870 |
| Protein Refseq | NP_003861 |
| MIM | 603379 |
| UniProt ID | P46940 |
| Chromosome Location | 15q26.1 |
| Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; C-MYB transcription factor network, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; E-cadherin signaling in the nascent adherens junction, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; |
| Function | GTPase activator activity; GTPase inhibitor activity; Rac GTPase binding; Ras GTPase activator activity; calmodulin binding; protein binding; protein phosphatase binding; |
| ◆ Recombinant Proteins | ||
| IQGAP1-23H | Recombinant Human IQGAP1 protein, GST-tagged | +Inquiry |
| Iqgap1-1190M | Recombinant Mouse Iqgap1 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IQGAP1 Products
Required fields are marked with *
My Review for All IQGAP1 Products
Required fields are marked with *
