Recombinant Human JAK2 (E596A, V617F, W659A, W777A, F794H) Protein, His tagged

Cat.No. : JAK2-32H
Product Overview : Recombinant Human JAK2 (JH2 Domain) (E596A, V617F, W659A, W777A, F794H) Protein with His tag was expressed in Insect Cells.
Availability January 07, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 536-812 aa (E596A, V617F, W659A, W777A, F794H)
Form : Sterile 50mM Tris, pH8.0, 200mM NaCl, 10% Glycerol, 2mM DTT
Molecular Mass : 32 kDa
AASequence : MVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFAAASMMSKLSHKHLVLNYGVCFCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLFTPDHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.36 mg/mL by Bradford
Gene Name JAK2 Janus kinase 2 [ Homo sapiens (human) ]
Official Symbol JAK2
Synonyms JAK2; Janus kinase 2; tyrosine-protein kinase JAK2; JTK10; JAK-2; Janus kinase 2 (a protein tyrosine kinase); THCYT3
Gene ID 3717
mRNA Refseq NM_004972
Protein Refseq NP_004963
MIM 147796
UniProt ID O60674

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JAK2 Products

Required fields are marked with *

My Review for All JAK2 Products

Required fields are marked with *

0
cart-icon
0
compare icon