Recombinant Human JAK2 (E596A, V617F, W659A, W777A, F794H) Protein, His tagged
| Cat.No. : | JAK2-32H |
| Product Overview : | Recombinant Human JAK2 (JH2 Domain) (E596A, V617F, W659A, W777A, F794H) Protein with His tag was expressed in Insect Cells. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 536-812 aa (E596A, V617F, W659A, W777A, F794H) |
| Form : | Sterile 50mM Tris, pH8.0, 200mM NaCl, 10% Glycerol, 2mM DTT |
| Molecular Mass : | 32 kDa |
| AASequence : | MVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFAAASMMSKLSHKHLVLNYGVCFCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLFTPDHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.36 mg/mL by Bradford |
| Gene Name | JAK2 Janus kinase 2 [ Homo sapiens (human) ] |
| Official Symbol | JAK2 |
| Synonyms | JAK2; Janus kinase 2; tyrosine-protein kinase JAK2; JTK10; JAK-2; Janus kinase 2 (a protein tyrosine kinase); THCYT3 |
| Gene ID | 3717 |
| mRNA Refseq | NM_004972 |
| Protein Refseq | NP_004963 |
| MIM | 147796 |
| UniProt ID | O60674 |
| ◆ Recombinant Proteins | ||
| JAK2-158H | Recombinant Human JAK2 protein, His/MBP-tagged | +Inquiry |
| JAK2-24H | Recombinant Human JAK2 (V617F) (JH1, JH2 Domain) Protein, GST/Avi-tagged, Biotin-labeled | +Inquiry |
| JAK2-3136R | Recombinant Rat JAK2 Protein | +Inquiry |
| JAK2-3184H | Recombinant Human JAK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| JAK2-598H | Recombinant Human JAK2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAK2 Products
Required fields are marked with *
My Review for All JAK2 Products
Required fields are marked with *
