Recombinant Human JAK2 (E596A, V617F, W659A, W777A, F794H) Protein, His tagged

• Cat.No.: JAK2-32H
• Product Overview: Recombinant Human JAK2 (JH2 Domain) (E596A, V617F, W659A, W777A, F794H) Protein with His tag was expressed in Insect Cells.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 536-812 aa (E596A, V617F, W659A, W777A, F794H)
• Form: Sterile 50mM Tris, pH8.0, 200mM NaCl, 10% Glycerol, 2mM DTT
• Molecular Mass: 32 kDa
• AASequence: MVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFAAASMMSKLSHKHLVLNYGVCFCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLFTPDHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.36 mg/mL by Bradford

Gene Information

• Gene Name: JAK2 Janus kinase 2 [ Homo sapiens (human) ]
• Official Symbol: JAK2
• Synonyms: JAK2; Janus kinase 2; tyrosine-protein kinase JAK2; JTK10; JAK-2; Janus kinase 2 (a protein tyrosine kinase); THCYT3
• Gene ID: 3717
• mRNA Refseq: NM_004972
• Protein Refseq: NP_004963
• MIM: 147796
• UniProt ID: O60674