Recombinant Human JAK2 (E596A, V617F, W659A, W777A, F794H) Protein, His tagged
Cat.No. : | JAK2-32H |
Product Overview : | Recombinant Human JAK2 (JH2 Domain) (E596A, V617F, W659A, W777A, F794H) Protein with His tag was expressed in Insect Cells. |
Availability | October 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 536-812 aa (E596A, V617F, W659A, W777A, F794H) |
Form : | Sterile 50mM Tris, pH8.0, 200mM NaCl, 10% Glycerol, 2mM DTT |
Molecular Mass : | 32 kDa |
AASequence : | MVFHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFAAASMMSKLSHKHLVLNYGVCFCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLFTPDHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.36 mg/mL by Bradford |
Gene Name | JAK2 Janus kinase 2 [ Homo sapiens (human) ] |
Official Symbol | JAK2 |
Synonyms | JAK2; Janus kinase 2; tyrosine-protein kinase JAK2; JTK10; JAK-2; Janus kinase 2 (a protein tyrosine kinase); THCYT3 |
Gene ID | 3717 |
mRNA Refseq | NM_004972 |
Protein Refseq | NP_004963 |
MIM | 147796 |
UniProt ID | O60674 |
◆ Native Proteins | ||
JAK2-32H | Recombinant Human JAK2 (E596A, V617F, W659A, W777A, F794H) Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAK2 Products
Required fields are marked with *
My Review for All JAK2 Products
Required fields are marked with *