Recombinant Human JSRP1 Protein, GST-tagged

Cat.No. : JSRP1-4304H
Product Overview : Human FLJ32416 partial ORF ( NP_653217.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The sarcoplasmic reticulum (SR) is an intracellular membrane compartment that controls intracellular calcium concentration and therefore plays a role in excitation-contraction coupling. In mouse skeletal muscle, Jp45 interacts with key proteins involved in excitation-contraction coupling at the SR (Anderson et al., 2003 [PubMed 12871958]).[supplied by OMIM
Molecular Mass : 36.74 kDa
AA Sequence : MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVDTRPKKMEKEPAARGTPGTGKERLKAGASPRSVPARKKAQT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name JSRP1 junctional sarcoplasmic reticulum protein 1 [ Homo sapiens (human) ]
Official Symbol JSRP1
Synonyms JSRP1; junctional sarcoplasmic reticulum protein 1; JP45; JP-45; junctional sarcoplasmic reticulum protein 1; 2310032K21Rik; homolog of mouse skeletal muscle sarcoplasmic reticulum protein JP-45; junctional-face membrane protein of 45 kDa homolog; skeletal muscle sarcoplasmic reticulum protein JP-45
Gene ID 126306
mRNA Refseq NM_144616
Protein Refseq NP_653217
MIM 608743
UniProt ID Q96MG2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JSRP1 Products

Required fields are marked with *

My Review for All JSRP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon