Recombinant Human JSRP1 Protein, GST-tagged
Cat.No. : | JSRP1-4304H |
Product Overview : | Human FLJ32416 partial ORF ( NP_653217.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The sarcoplasmic reticulum (SR) is an intracellular membrane compartment that controls intracellular calcium concentration and therefore plays a role in excitation-contraction coupling. In mouse skeletal muscle, Jp45 interacts with key proteins involved in excitation-contraction coupling at the SR (Anderson et al., 2003 [PubMed 12871958]).[supplied by OMIM |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MSMTTRAWEELDGGLGSCQALEDHSALAETQEDRASATPRLADSGSVPHDSQVAEGPSVDTRPKKMEKEPAARGTPGTGKERLKAGASPRSVPARKKAQT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | JSRP1 junctional sarcoplasmic reticulum protein 1 [ Homo sapiens (human) ] |
Official Symbol | JSRP1 |
Synonyms | JSRP1; junctional sarcoplasmic reticulum protein 1; JP45; JP-45; junctional sarcoplasmic reticulum protein 1; 2310032K21Rik; homolog of mouse skeletal muscle sarcoplasmic reticulum protein JP-45; junctional-face membrane protein of 45 kDa homolog; skeletal muscle sarcoplasmic reticulum protein JP-45 |
Gene ID | 126306 |
mRNA Refseq | NM_144616 |
Protein Refseq | NP_653217 |
MIM | 608743 |
UniProt ID | Q96MG2 |
◆ Recombinant Proteins | ||
JSRP1-2339H | Recombinant Human JSRP1, His-tagged | +Inquiry |
JSRP1-4304H | Recombinant Human JSRP1 Protein, GST-tagged | +Inquiry |
JSRP1-212H | Recombinant Human JSRP1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JSRP1-351HCL | Recombinant Human JSRP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JSRP1 Products
Required fields are marked with *
My Review for All JSRP1 Products
Required fields are marked with *
0
Inquiry Basket