Recombinant Human KBTBD10 protein, His-tagged

Cat.No. : KBTBD10-2556H
Product Overview : Recombinant Human KBTBD10 protein(205-382 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability December 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 205-382 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AASequence : RTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVVGGLYVDEENKDQPLQSYFFQLDSIASEWVGLP
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name KBTBD10 kelch repeat and BTB (POZ) domain containing 10 [ Homo sapiens ]
Official Symbol KBTBD10
Synonyms KBTBD10; kelch repeat and BTB (POZ) domain containing 10; kelch repeat and BTB domain-containing protein 10; sarcomeric muscle protein; SARCOSIN; kel-like protein 23; kelch-related protein 1; FLJ60989;
Gene ID 10324
mRNA Refseq NM_006063
Protein Refseq NP_006054
MIM 607701
UniProt ID O60662

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KBTBD10 Products

Required fields are marked with *

My Review for All KBTBD10 Products

Required fields are marked with *

0
cart-icon
0
compare icon