Recombinant Human KCNIP1 protein, GST-tagged

Cat.No. : KCNIP1-5643H
Product Overview : Recombinant Human KCNIP1 protein(1-216 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 1-216 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name KCNIP1 Kv channel interacting protein 1 [ Homo sapiens ]
Official Symbol KCNIP1
Synonyms KCNIP1; Kv channel interacting protein 1; Kv channel-interacting protein 1; KCHIP1; vesicle APC-binding protein; potassium channel interacting protein 1; potassium channel-interacting protein 1; A-type potassium channel modulatory protein 1; VABP; MGC95;
mRNA Refseq NM_001034837
Protein Refseq NP_001030009
MIM 604660
UniProt ID Q9NZI2
Gene ID 30820

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNIP1 Products

Required fields are marked with *

My Review for All KCNIP1 Products

Required fields are marked with *

0
cart-icon