"KCNMB2" Related Products

Expand
Expand

Recombinant Human KCNMB2 Protein, GST-tagged

Cat.No.: KCNMB2-033H
Product Overview: Human KCNMB2 full-length ORF ( AAH17825, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
Description: MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which decreases the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants of this gene. Additional variants are discussed in the literature, but their full length nature has not been described.
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 51.59 kDa
AA Sequence: MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMTVCSIMMYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNLTSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKGVILTKLYSSSVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Stability: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: KCNMB2 potassium calcium-activated channel subfamily M regulatory beta subunit 2 [ Homo sapiens (human) ]
Official Symbol: KCNMB2
Synonyms: KCNMB2; potassium calcium-activated channel subfamily M regulatory beta subunit 2; calcium-activated potassium channel subunit beta-2; BK channel beta subunit 2; BK channel subunit beta-2; MaxiK channel beta 2 subunit; MaxiK channel beta-subunit 2; big potassium channel beta subunit 2; charybdotoxin receptor subunit beta-2; hCG1646471; hbeta2; k(VCA)beta-2; large conductance calcium-activated potassium channel beta 2 subunit; large-conductance Ca2+-activated K+ channel beta2 subunit; potassium channel subfamily M regulatory beta subunit 2; potassium large conductance calcium-activated channel, subfamily M, beta member 2; slo-beta-2
Gene ID: 10242
mRNA Refseq: NM_181361
Protein Refseq: NP_852006
MIM: 605214
UniProt ID: Q9Y691

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.