Recombinant Human KCNQ1DN protein, His-tagged
Cat.No. : | KCNQ1DN-2179H |
Product Overview : | Recombinant Human KCNQ1DN protein(1-68 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-68 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MGRKWSGPTAEHQLPMPPPGVRLDSWKGVASGCSPSKASQEARGKEKCPTLNGQPQWSALFTLPPQRE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | KCNQ1DN |
Synonyms | KCNQ1DN; BWRT; HSA404617; KCNQ1 downstream neighbor (non-protein coding) |
Gene ID | 55539 |
MIM | 610980 |
UniProt ID | Q9H478 |
◆ Recombinant Proteins | ||
KCNQ1DN-278H | Recombinant Human KCNQ1DN protein, GST-tagged | +Inquiry |
KCNQ1DN-2179H | Recombinant Human KCNQ1DN protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNQ1DN Products
Required fields are marked with *
My Review for All KCNQ1DN Products
Required fields are marked with *
0
Inquiry Basket