Recombinant Human KDM2A protein, GST-tagged

Cat.No. : KDM2A-300H
Product Overview : Recombinant Human KDM2A protein(374-558 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability December 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 374-558 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : DEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKTLAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAAS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol KDM2A
Synonyms KDM2A; lysine (K)-specific demethylase 2A; F box and leucine rich repeat protein 11 , FBXL11; lysine-specific demethylase 2A; CXXC8; DKFZP434M1735; F box protein FBL11; FBL7; FBL11; FLJ00115; JHDM1A; jumonji C domain containing histone demethylase 1A; KIAA1004; LILINA; F-box/LRR-repeat protein 11; CXXC-type zinc finger protein 8; [Histone-H3]-lysine-36 demethylase 1A; F-box and leucine-rich repeat protein 11; jumonji C domain-containing histone demethylase 1A; jmjC domain-containing histone demethylation protein 1A; FBXL11; FLJ46431; DKFZp434M1735;
Gene ID 22992
mRNA Refseq NM_001256405
Protein Refseq NP_001243334
MIM 605657
UniProt ID Q9Y2K7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KDM2A Products

Required fields are marked with *

My Review for All KDM2A Products

Required fields are marked with *

0
cart-icon
0
compare icon