Recombinant Human KDM2A protein, GST-tagged

• Cat.No.: KDM2A-300H
• Product Overview: Recombinant Human KDM2A protein(374-558 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 374-558 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: DEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKTLAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAAS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: KDM2A
• Synonyms: KDM2A; lysine (K)-specific demethylase 2A; F box and leucine rich repeat protein 11 , FBXL11; lysine-specific demethylase 2A; CXXC8; DKFZP434M1735; F box protein FBL11; FBL7; FBL11; FLJ00115; JHDM1A; jumonji C domain containing histone demethylase 1A; KIAA1004; LILINA; F-box/LRR-repeat protein 11; CXXC-type zinc finger protein 8; [Histone-H3]-lysine-36 demethylase 1A; F-box and leucine-rich repeat protein 11; jumonji C domain-containing histone demethylase 1A; jmjC domain-containing histone demethylation protein 1A; FBXL11; FLJ46431; DKFZp434M1735
• Gene ID: 22992
• mRNA Refseq: NM_001256405
• Protein Refseq: NP_001243334
• MIM: 605657
• UniProt ID: Q9Y2K7