Recombinant Human KDM3B Protein, His-SUMO/MYC-tagged
Cat.No. : | KDM3B-1266H |
Product Overview : | Recombinant Human KDM3B protein (1498-1721aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 1498-1721 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAV NVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQG QENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSP EHVKHCFRLTQEFR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | KDM3B lysine (K)-specific demethylase 3B [ Homo sapiens ] |
Official Symbol | KDM3B |
Synonyms | KDM3B; lysine (K)-specific demethylase 3B; C5orf7, chromosome 5 open reading frame 7 , JMJD1B, jumonji domain containing 1B; lysine-specific demethylase 3B; KIAA1082; NET22; nuclear protein 5qNCA; jumonji domain containing 1B; jumonji domain-containing protein 1B; jmjC domain-containing histone demethylation protein 2B; 5qNCA; C5orf7; JMJD1B |
Gene ID | 51780 |
mRNA Refseq | NM_016604 |
Protein Refseq | NP_057688 |
MIM | 609373 |
UniProt ID | Q7LBC6 |
◆ Recombinant Proteins | ||
KDM3B-2358H | Recombinant Human KDM3B Protein, His-tagged | +Inquiry |
KDM3B-49H | Active Recombinant Human KDM3B, FLAG-tagged | +Inquiry |
KDM3B-302H | Recombinant Human KDM3B, His-tagged | +Inquiry |
KDM3B-1266H | Recombinant Human KDM3B Protein, His-SUMO/MYC-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDM3B-2123HCL | Recombinant Human KDM3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KDM3B Products
Required fields are marked with *
My Review for All KDM3B Products
Required fields are marked with *