Recombinant Human KLF8 protein, GST-tagged
| Cat.No. : | KLF8-301536H |
| Product Overview : | Recombinant Human KLF8 (207-284 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Gly207-Val284 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | GGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKV |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | KLF8 Kruppel-like factor 8 [ Homo sapiens ] |
| Official Symbol | KLF8 |
| Synonyms | KLF8; Kruppel-like factor 8; Krueppel-like factor 8; BKLF3; DXS741; ZNF741; zinc finger protein 741; basic kruppel-like factor 3; basic krueppel-like factor 3; MGC138314; DKFZp686O08126; |
| Gene ID | 11279 |
| mRNA Refseq | NM_001159296 |
| Protein Refseq | NP_001152768 |
| MIM | 300286 |
| UniProt ID | O95600 |
| ◆ Recombinant Proteins | ||
| KLF8-301536H | Recombinant Human KLF8 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLF8-940HCL | Recombinant Human KLF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLF8 Products
Required fields are marked with *
My Review for All KLF8 Products
Required fields are marked with *
