Recombinant Human KLF8 protein, GST-tagged

Cat.No. : KLF8-301536H
Product Overview : Recombinant Human KLF8 (207-284 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Gly207-Val284
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : GGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKV
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name KLF8 Kruppel-like factor 8 [ Homo sapiens ]
Official Symbol KLF8
Synonyms KLF8; Kruppel-like factor 8; Krueppel-like factor 8; BKLF3; DXS741; ZNF741; zinc finger protein 741; basic kruppel-like factor 3; basic krueppel-like factor 3; MGC138314; DKFZp686O08126;
Gene ID 11279
mRNA Refseq NM_001159296
Protein Refseq NP_001152768
MIM 300286
UniProt ID O95600

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLF8 Products

Required fields are marked with *

My Review for All KLF8 Products

Required fields are marked with *

0
cart-icon