Recombinant Human KLHDC3 Protein, His&Myc-tagged
| Cat.No. : | KLHDC3-405H |
| Product Overview : | Recombinant Human KLHDC3 Protein(Q9BQ90)(1-382aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
| Availability | June 17, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-382aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50.5 kDa |
| AA Sequence : | MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRVSGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGSPARWRDFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVGDKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDIRWELNAMTTNSNISRPIVSSHG |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | KLHDC3 kelch domain containing 3 [ Homo sapiens ] |
| Official Symbol | KLHDC3 |
| Synonyms | KLHDC3; kelch domain containing 3; kelch domain-containing protein 3; dJ20C7.3; hPeas; PEAS; protein Peas; testis intracellular mediator protein; hPEAS; RP1-20C7.3; |
| Gene ID | 116138 |
| mRNA Refseq | NM_001242872 |
| Protein Refseq | NP_001229801 |
| MIM | 611248 |
| UniProt ID | Q9BQ90 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLHDC3 Products
Required fields are marked with *
My Review for All KLHDC3 Products
Required fields are marked with *
