Recombinant Human KLHDC8B protein, His-tagged
Cat.No. : | KLHDC8B-8865H |
Product Overview : | Recombinant Human KLHDC8B protein(70-178 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 70-178 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | AGAAAVVLGKQVLVVGGVDEVQSPVAAVEAFLMDEGRWERRATLPQAAMGVATVERDGMVYALGGMGPDTAPQAQVRVYEPRRDCWLSLPSMPTPCYGASTFLHGNKIY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | KLHDC8B kelch domain containing 8B [ Homo sapiens ] |
Official Symbol | KLHDC8B |
Synonyms | KLHDC8B; kelch domain containing 8B; kelch domain-containing protein 8B; MGC35097; FLJ11302; |
Gene ID | 200942 |
mRNA Refseq | NM_173546 |
Protein Refseq | NP_775817 |
MIM | 613169 |
UniProt ID | Q8IXV7 |
◆ Recombinant Proteins | ||
KLHDC8B-3276R | Recombinant Rat KLHDC8B Protein | +Inquiry |
KLHDC8B-4848M | Recombinant Mouse KLHDC8B Protein, His (Fc)-Avi-tagged | +Inquiry |
KLHDC8B-8865H | Recombinant Human KLHDC8B protein, His-tagged | +Inquiry |
KLHDC8B-8699M | Recombinant Mouse KLHDC8B Protein | +Inquiry |
KLHDC8B-2239R | Recombinant Rhesus Macaque KLHDC8B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLHDC8B-367HCL | Recombinant Human KLHDC8B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLHDC8B Products
Required fields are marked with *
My Review for All KLHDC8B Products
Required fields are marked with *