Recombinant Human KLK2 protein, GST-tagged
| Cat.No. : | KLK2-153H |
| Product Overview : | Recombinant Human KLK2(1 a.a. - 261 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-261 a.a. |
| Description : | This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded by this gene is a highly active trypsin-like serine protease that selectively cleaves at arginine residues. This protein is primarily expressed in prostatic tissue and is responsible for cleaving pro-prostate-specific antigen into its enzymatically active form. This gene is highly expressed in prostate tumor cells and may be a prognostic maker for prostate cancer risk. Alternate splicing results in both coding and non-coding transcript variants. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 54.34 kDa |
| AA Sequence : | MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWL GRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGT TCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQG ITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | KLK2 kallikrein-related peptidase 2 [ Homo sapiens ] |
| Official Symbol | KLK2 |
| Synonyms | KLK2; kallikrein-related peptidase 2; kallikrein 2, prostatic; kallikrein-2; tissue kallikrein-2; glandular kallikrein 2; glandular kallikrein-1; hK2; hGK-1; KLK2A2; FLJ17010; FLJ17011; MGC12201; |
| Gene ID | 3817 |
| mRNA Refseq | NM_001002231 |
| Protein Refseq | NP_001002231 |
| MIM | 147960 |
| UniProt ID | P20151 |
| Chromosome Location | 19q13.33 |
| Pathway | Activation of Matrix Metalloproteinases, organism-specific biosystem; Coregulation of Androgen receptor activity, organism-specific biosystem; Degradation of the extracellular matrix, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, organism-specific biosystem; Endocrine and other factor-regulated calcium reabsorption, conserved biosystem |
| Function | peptidase activity; serine-type endopeptidase activity; |
| ◆ Recombinant Proteins | ||
| KLK2-239HFL | Recombinant Full Length Human KLK2 Protein, C-Flag-tagged | +Inquiry |
| KLK2-221H | Recombinant Human kallikrein-related peptidase 2, His-tagged | +Inquiry |
| KLK2-3232H | Recombinant Human KLK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KLK2-2373H | Recombinant Human KLK2 Protein, His-tagged | +Inquiry |
| KLK2-152H | Active Recombinant Human KLK2 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLK2-947HCL | Recombinant Human KLK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLK2 Products
Required fields are marked with *
My Review for All KLK2 Products
Required fields are marked with *
