Recombinant Human KNL1 Protein, GST-Tagged

Cat.No. : KNL1-0410H
Product Overview : Human CASC5 partial ORF (NP_733468, 3 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a component of the multiprotein assembly that is required for creation of kinetochore-microtubule attachments and chromosome segregation. The encoded protein functions as a scaffold for proteins that influence the spindle assembly checkpoint during the eukaryotic cell cycle and it interacts with at least five different kinetochore proteins and two checkpoint kinases. In adults, this gene is predominantly expressed in normal testes, various cancer cell lines and primary tumors from other tissues and is ubiquitously expressed in fetal tissues. This gene was originally identified as a fusion partner with the mixed-lineage leukemia (MLL) gene in t(11;15)(q23;q14). Mutations in this gene cause autosomal recessive primary microcephaly-4 (MCPH4). Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described but their biological validity has not been confirmed. [provided by RefSeq, Jan 2013]
Molecular Mass : 36.3 kDa
AA Sequence : GVSSEANEENDNIERPVRRRHSSILKPPRSPLQDHRGGNERVQESNALRNKKNSRRVSFADTIKVFQTESHMKIVRKSEMEGCSAMVPSQLQLLPP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KNL1 kinetochore scaffold 1 [ Homo sapiens (human) ]
Official Symbol KNL1
Synonyms KNL1; kinetochore scaffold 1; CASC5; cancer susceptibility candidate 5; protein CASC5; AF15Q14; blinkin; bub linking kinetochore protein; cancer/testis antigen 29; CT29; D40; hKNL 1; hSpc105; kinetochore null 1 homolog (C. elegans); KNL1; PPP1R55; protein phosphatase 1; regulatory subunit 55; kinetochore null 1 homolog; kinetochore-null protein 1; bub-linking kinetochore protein; blinkin, bub-linking kinetochore protein; protein phosphatase 1, regulatory subunit 55; ALL1-fused gene from chromosome 15q14 protein; cancer susceptibility candidate gene 5 protein; hKNL-1; KIAA1570;
Gene ID 57082
mRNA Refseq NM_144508
Protein Refseq NP_653091
MIM 609173
UniProt ID Q8NG31

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KNL1 Products

Required fields are marked with *

My Review for All KNL1 Products

Required fields are marked with *

0
cart-icon