Recombinant Human KNL1 Protein, GST-Tagged
| Cat.No. : | KNL1-0410H |
| Product Overview : | Human CASC5 partial ORF (NP_733468, 3 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a component of the multiprotein assembly that is required for creation of kinetochore-microtubule attachments and chromosome segregation. The encoded protein functions as a scaffold for proteins that influence the spindle assembly checkpoint during the eukaryotic cell cycle and it interacts with at least five different kinetochore proteins and two checkpoint kinases. In adults, this gene is predominantly expressed in normal testes, various cancer cell lines and primary tumors from other tissues and is ubiquitously expressed in fetal tissues. This gene was originally identified as a fusion partner with the mixed-lineage leukemia (MLL) gene in t(11;15)(q23;q14). Mutations in this gene cause autosomal recessive primary microcephaly-4 (MCPH4). Alternative splicing results in multiple transcript variants encoding different isoforms. Additional splice variants have been described but their biological validity has not been confirmed. [provided by RefSeq, Jan 2013] |
| Molecular Mass : | 36.3 kDa |
| AA Sequence : | GVSSEANEENDNIERPVRRRHSSILKPPRSPLQDHRGGNERVQESNALRNKKNSRRVSFADTIKVFQTESHMKIVRKSEMEGCSAMVPSQLQLLPP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KNL1 kinetochore scaffold 1 [ Homo sapiens (human) ] |
| Official Symbol | KNL1 |
| Synonyms | KNL1; kinetochore scaffold 1; CASC5; cancer susceptibility candidate 5; protein CASC5; AF15Q14; blinkin; bub linking kinetochore protein; cancer/testis antigen 29; CT29; D40; hKNL 1; hSpc105; kinetochore null 1 homolog (C. elegans); KNL1; PPP1R55; protein phosphatase 1; regulatory subunit 55; kinetochore null 1 homolog; kinetochore-null protein 1; bub-linking kinetochore protein; blinkin, bub-linking kinetochore protein; protein phosphatase 1, regulatory subunit 55; ALL1-fused gene from chromosome 15q14 protein; cancer susceptibility candidate gene 5 protein; hKNL-1; KIAA1570; |
| Gene ID | 57082 |
| mRNA Refseq | NM_144508 |
| Protein Refseq | NP_653091 |
| MIM | 609173 |
| UniProt ID | Q8NG31 |
| ◆ Recombinant Proteins | ||
| KNL1-3165H | Recombinant Human KNL1 protein, His-tagged | +Inquiry |
| KNL1-0410H | Recombinant Human KNL1 Protein, GST-Tagged | +Inquiry |
| Knl1-1723M | Recombinant Mouse Knl1 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KNL1 Products
Required fields are marked with *
My Review for All KNL1 Products
Required fields are marked with *
