Recombinant Human KNTC1 Protein, GST-tagged
Cat.No. : | KNTC1-4900H |
Product Overview : | Human KNTC1 partial ORF ( NP_055523, 2100 a.a. - 2209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KNTC1 kinetochore associated 1 [ Homo sapiens ] |
Official Symbol | KNTC1 |
Synonyms | KNTC1; kinetochore associated 1; kinetochore-associated protein 1; KIAA0166; ROD; rough deal homolog (Drosophila); Rough Deal homolog, centromere/kinetochore protein; FLJ36151; |
Gene ID | 9735 |
mRNA Refseq | NM_014708 |
Protein Refseq | NP_055523 |
MIM | 607363 |
UniProt ID | P50748 |
◆ Recombinant Proteins | ||
KNTC1-4900H | Recombinant Human KNTC1 Protein, GST-tagged | +Inquiry |
KNTC1-8796M | Recombinant Mouse KNTC1 Protein | +Inquiry |
KNTC1-4894M | Recombinant Mouse KNTC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KNTC1 Products
Required fields are marked with *
My Review for All KNTC1 Products
Required fields are marked with *