Recombinant Human KNTC1 Protein, GST-tagged

Cat.No. : KNTC1-4900H
Product Overview : Human KNTC1 partial ORF ( NP_055523, 2100 a.a. - 2209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KNTC1 kinetochore associated 1 [ Homo sapiens ]
Official Symbol KNTC1
Synonyms KNTC1; kinetochore associated 1; kinetochore-associated protein 1; KIAA0166; ROD; rough deal homolog (Drosophila); Rough Deal homolog, centromere/kinetochore protein; FLJ36151;
Gene ID 9735
mRNA Refseq NM_014708
Protein Refseq NP_055523
MIM 607363
UniProt ID P50748

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KNTC1 Products

Required fields are marked with *

My Review for All KNTC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon