Recombinant Human KNTC1 Protein, GST-tagged

• Cat.No.: KNTC1-4900H
• Product Overview: Human KNTC1 partial ORF ( NP_055523, 2100 a.a. - 2209 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that is one of many involved in mechanisms to ensure proper chromosome segregation during cell division. Experimental evidence indicated that the encoded protein functioned in a similar manner to that of the Drosophila rough deal protein. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: DPQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNITELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KNTC1 kinetochore associated 1 [ Homo sapiens ]
• Official Symbol: KNTC1
• Synonyms: KNTC1; kinetochore associated 1; kinetochore-associated protein 1; KIAA0166; ROD; rough deal homolog (Drosophila); Rough Deal homolog, centromere/kinetochore protein; FLJ36151
• Gene ID: 9735
• mRNA Refseq: NM_014708
• Protein Refseq: NP_055523
• MIM: 607363
• UniProt ID: P50748