Recombinant Human KRTAP13-1 Protein, GST-tagged
Cat.No. : | KRTAP13-1-4824H |
Product Overview : | Human KRTAP13-1 full-length ORF ( AAI13539.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-193 a.a. |
Description : | Hair keratins and hair keratin-associated proteins (KAPs), such as KRTAP13-1, are the main structural proteins of hair fibers (Rogers et al., 2002 [PubMed 12359730]).[supplied by OMIM |
Molecular Mass : | 47 kDa |
AA Sequence : | MWHANSESSQCNSAELTSPINMSYNCCSGNFSSRSCGGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGSSLYRGCQQTCWEPTSCQTSYVESSPCQTSCYRPRTSLLCSPCQTTYSGSLGFGSSSCRSLGYGSRSCYSVGCGSSGFRSLGYGGCGFPSLGYGVGFCRPTYLASRSCQSSCYRPTCGSGFYY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRTAP13-1 keratin associated protein 13-1 [ Homo sapiens ] |
Official Symbol | KRTAP13-1 |
Synonyms | KRTAP13-1; keratin associated protein 13-1; KAP13.1; |
Gene ID | 337881 |
MIM | 608718 |
UniProt ID | Q8IUC0 |
◆ Recombinant Proteins | ||
KRTAP13-1-5802HF | Recombinant Full Length Human KRTAP13-1 Protein, GST-tagged | +Inquiry |
KRTAP13-1-4824H | Recombinant Human KRTAP13-1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP13-1 Products
Required fields are marked with *
My Review for All KRTAP13-1 Products
Required fields are marked with *
0
Inquiry Basket