Recombinant Human KRTAP13-1 Protein, GST-tagged

Cat.No. : KRTAP13-1-4824H
Product Overview : Human KRTAP13-1 full-length ORF ( AAI13539.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-193 a.a.
Description : Hair keratins and hair keratin-associated proteins (KAPs), such as KRTAP13-1, are the main structural proteins of hair fibers (Rogers et al., 2002 [PubMed 12359730]).[supplied by OMIM
Molecular Mass : 47 kDa
AA Sequence : MWHANSESSQCNSAELTSPINMSYNCCSGNFSSRSCGGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGSSLYRGCQQTCWEPTSCQTSYVESSPCQTSCYRPRTSLLCSPCQTTYSGSLGFGSSSCRSLGYGSRSCYSVGCGSSGFRSLGYGGCGFPSLGYGVGFCRPTYLASRSCQSSCYRPTCGSGFYY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP13-1 keratin associated protein 13-1 [ Homo sapiens ]
Official Symbol KRTAP13-1
Synonyms KRTAP13-1; keratin associated protein 13-1; KAP13.1;
Gene ID 337881
MIM 608718
UniProt ID Q8IUC0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRTAP13-1 Products

Required fields are marked with *

My Review for All KRTAP13-1 Products

Required fields are marked with *

0
cart-icon
0
compare icon