Recombinant Human KRTAP26-1 Protein, GST-tagged
| Cat.No. : | KRTAP26-1-4815H |
| Product Overview : | Human KRTAP26-1 full-length ORF (AAH57825.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-210 a.a. |
| Description : | KRTAP26-1 (Keratin Associated Protein 26-1) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. |
| Molecular Mass : | 49.5 kDa |
| AA Sequence : | MSCPNYCSGNSNSGSLRTSRHIPLTSIDLCPTSVSCGDVLYLPTSSQDHTWVTDNCQETCGEPTSCQPVHCETGNLETSCGSSTAYYVPRPCQGSSFLPASFFSSSCLPVSCRPQRYVSSGCRPLRPLLNSYQPIGDCVPNAYRPQFCLSKSCQPQNLLTSGCQPSSCLAYRPQSLHVVSSSLRPLGPLFSGCQPLTHVFSTCRPSCSGL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KRTAP26-1 keratin associated protein 26-1 [ Homo sapiens (human) ] |
| Official Symbol | KRTAP26-1 |
| Synonyms | KRTAP26-1; keratin associated protein 26-1; keratin-associated protein 26-1; |
| Gene ID | 388818 |
| mRNA Refseq | NM_203405 |
| Protein Refseq | NP_981950 |
| UniProt ID | Q6PEX3 |
| ◆ Recombinant Proteins | ||
| KRTAP26-1-5810HF | Recombinant Full Length Human KRTAP26-1 Protein, GST-tagged | +Inquiry |
| KRTAP26-1-8883M | Recombinant Mouse KRTAP26-1 Protein | +Inquiry |
| KRTAP26-1-4955M | Recombinant Mouse KRTAP26-1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KRTAP26-1-4815H | Recombinant Human KRTAP26-1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP26-1 Products
Required fields are marked with *
My Review for All KRTAP26-1 Products
Required fields are marked with *
