Recombinant Human KRTAP26-1 Protein, GST-tagged

Cat.No. : KRTAP26-1-4815H
Product Overview : Human KRTAP26-1 full-length ORF (AAH57825.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-210 a.a.
Description : KRTAP26-1 (Keratin Associated Protein 26-1) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology.
Molecular Mass : 49.5 kDa
AA Sequence : MSCPNYCSGNSNSGSLRTSRHIPLTSIDLCPTSVSCGDVLYLPTSSQDHTWVTDNCQETCGEPTSCQPVHCETGNLETSCGSSTAYYVPRPCQGSSFLPASFFSSSCLPVSCRPQRYVSSGCRPLRPLLNSYQPIGDCVPNAYRPQFCLSKSCQPQNLLTSGCQPSSCLAYRPQSLHVVSSSLRPLGPLFSGCQPLTHVFSTCRPSCSGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP26-1 keratin associated protein 26-1 [ Homo sapiens (human) ]
Official Symbol KRTAP26-1
Synonyms KRTAP26-1; keratin associated protein 26-1; keratin-associated protein 26-1;
Gene ID 388818
mRNA Refseq NM_203405
Protein Refseq NP_981950
UniProt ID Q6PEX3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRTAP26-1 Products

Required fields are marked with *

My Review for All KRTAP26-1 Products

Required fields are marked with *

0
cart-icon