Recombinant Human KRTAP4-5 Protein, GST-tagged
| Cat.No. : | KRTAP4-5-4810H |
| Product Overview : | Human KRTAP4-5 full-length ORF ( AAI60148.1, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-181 a.a. |
| Description : | This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the ultrahigh sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq |
| Molecular Mass : | 20 kDa |
| AA Sequence : | MVSSCCGSVSSEQSCGLENCCRPSCCQTTCCRTTCCRPSCCKPQCCQSVCYQPTCCHPSCCISSCCRPYCCESSCCRPCCCQTTCCRTTCCRTTCCCPSCCVSSCCRPQCCQSVCCQPTCCRPSCCISSCCHPSCCESSCCRPCCCVRPVCGRVSCHTTCYRPTCVISTCPRPLCCASSCC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KRTAP4-5 keratin associated protein 4-5 [ Homo sapiens (human) ] |
| Official Symbol | KRTAP4-5 |
| Synonyms | KRTAP4-5; keratin associated protein 4-5; KAP4.5; KRTAP4.5; keratin-associated protein 4-5; keratin-associated protein 4.5; ultrahigh sulfur keratin-associated protein 4.5 |
| Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=85289 |
| mRNA Refseq | NM_033188 |
| Protein Refseq | NP_149445 |
| UniProt ID | Q9BYR2 |
| ◆ Recombinant Proteins | ||
| KRTAP4-5-3297H | Recombinant Human KRTAP4-5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KRTAP4-5-5824HF | Recombinant Full Length Human KRTAP4-5 Protein, GST-tagged | +Inquiry |
| KRTAP4-5-4810H | Recombinant Human KRTAP4-5 Protein, GST-tagged | +Inquiry |
| KRTAP4-5-1588H | Recombinant Human KRTAP4-5 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP4-5 Products
Required fields are marked with *
My Review for All KRTAP4-5 Products
Required fields are marked with *
