Recombinant Human KYAT3 Protein, GST-Tagged
| Cat.No. : | KYAT3-0494H |
| Product Overview : | Human CCBL2 full-length ORF (NP_001008661.1, 1 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. [provided by RefSeq, Mar 2017] |
| Molecular Mass : | 77.8 kDa |
| AA Sequence : | MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KYAT3 kynurenine aminotransferase 3 [ Homo sapiens (human) ] |
| Official Symbol | KYAT3 |
| Synonyms | KYAT3; kynurenine aminotransferase 3; KAT3; KATIII; RP11-82K18.3; RP4-531M19.2; Kynurenine Aminotransferase 3; Kynurenine--Oxoglutarate Transaminase III; Kynurenine--Oxoglutarate Transaminase 3; Kynurenine--Glyoxylate Transaminase; Cysteine-S-Conjugate Beta-Lyase 2; Kynurenine Aminotransferase III; CCBL2; Cysteine Conjugate Beta Lyase |
| Gene ID | 56267 |
| mRNA Refseq | NM_001008662 |
| Protein Refseq | NP_001008662 |
| MIM | 610656 |
| UniProt ID | Q6YP21 |
| ◆ Recombinant Proteins | ||
| Kyat3-1081M | Recombinant Mouse Kyat3 Protein, His-tagged | +Inquiry |
| KYAT3-1016H | Recombinant Human KYAT3 Protein, MYC/DDK-tagged | +Inquiry |
| KYAT3-0494H | Recombinant Human KYAT3 Protein, GST-Tagged | +Inquiry |
| KYAT3-219H | Recombinant Human KYAT3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KYAT3-1269H | Recombinant Human KYAT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KYAT3 Products
Required fields are marked with *
My Review for All KYAT3 Products
Required fields are marked with *
