Recombinant Human LAX1 protein, His-tagged
Cat.No. : | LAX1-3642H |
Product Overview : | Recombinant Human LAX1 protein(77-398 aa), fused to His tag, was expressed in E. coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 77-398 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GIYDNAMVPQMCGNLTPSAHCINVRASRDCASISSEDSHDYVNVPTAEEIAETLASTKSPSRNLFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQERQLWVAFQCCRDYENVPAADPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLLPDE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LAX1 lymphocyte transmembrane adaptor 1 [ Homo sapiens ] |
Official Symbol | LAX1 |
Synonyms | LAX1; lymphocyte transmembrane adaptor 1; lymphocyte transmembrane adapter 1; FLJ20340; LAT like membrane associated protein; LAX; linker for activation of x cells; LAT-like membrane associated protein; membrane-associated adapter protein LAX; |
Gene ID | 54900 |
mRNA Refseq | NM_001136190 |
Protein Refseq | NP_001129662 |
UniProt ID | Q8IWV1 |
◆ Recombinant Proteins | ||
LAX1-3017R | Recombinant Rat LAX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAX1-8972M | Recombinant Mouse LAX1 Protein | +Inquiry |
LAX1-3642H | Recombinant Human LAX1 protein, His-tagged | +Inquiry |
LAX1-3361R | Recombinant Rat LAX1 Protein | +Inquiry |
LAX1-5004M | Recombinant Mouse LAX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAX1-4812HCL | Recombinant Human LAX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAX1 Products
Required fields are marked with *
My Review for All LAX1 Products
Required fields are marked with *