Recombinant Human LEP Protein
| Cat.No. : | LEP-201H |
| Product Overview : | Recombinant Human LEP Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | Leptin is a hormone that is produced by adipose tissue and plays critical roles in the physiologic regulation of body weight. Leptin acts through the leptin receptor (LEPR) to regulate adipose mass by inhibiting hunger and balancing energy usage. Leptin mutations cause severe hereditary obesity and hypogonadism in rodents and humans. Leptin also has thermogenic actions, regulates enzymes of fatty acid oxidation, and is involved in hematopoiesis, angiogenesis, wound healing, inflammation, and immune responses. |
| Bio-activity : | No biological activity data is available at this time. |
| Molecular Mass : | Monomer, 16.2 kDa (147 aa) |
| AA Sequence : | MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | LEP leptin [ Homo sapiens (human) ] |
| Official Symbol | LEP |
| Synonyms | LEP; leptin; leptin (murine obesity homolog) , leptin (obesity homolog, mouse) , OB, OBS; obese protein; obesity factor; obese, mouse, homolog of; leptin (murine obesity homolog); leptin (obesity homolog, mouse); OB; OBS; FLJ94114; |
| Gene ID | 3952 |
| mRNA Refseq | NM_000230 |
| Protein Refseq | NP_000221 |
| MIM | 164160 |
| UniProt ID | Q6NT58 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEP Products
Required fields are marked with *
My Review for All LEP Products
Required fields are marked with *
