Recombinant Human LEPROTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LEPROTL1-1599H
Product Overview : LEPROTL1 MS Standard C13 and N15-labeled recombinant protein (NP_056159) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LEPROTL1 (Leptin Receptor Overlapping Transcript Like 1) is a Protein Coding gene. Diseases associated with LEPROTL1 include Rectum Adenocarcinoma. An important paralog of this gene is LEPROT.
Molecular Mass : 14.4 kDa
AA Sequence : MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LEPROTL1 leptin receptor overlapping transcript like 1 [ Homo sapiens (human) ]
Official Symbol LEPROTL1
Synonyms LEPROTL1; leptin receptor overlapping transcript like 1; leptin receptor overlapping transcript-like 1; endospanin-2
Gene ID 23484
mRNA Refseq NM_015344
Protein Refseq NP_056159
MIM 607338
UniProt ID O95214

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LEPROTL1 Products

Required fields are marked with *

My Review for All LEPROTL1 Products

Required fields are marked with *

0
cart-icon