Recombinant Full Length Human Leptin Receptor Overlapping Transcript-Like 1(Leprotl1) Protein, His-Tagged
Cat.No. : | RFL7514HF |
Product Overview : | Recombinant Full Length Human Leptin receptor overlapping transcript-like 1(LEPROTL1) Protein (O95214) (1-131aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-131) |
Form : | Lyophilized powder |
AA Sequence : | MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LEPROTL1 |
Synonyms | LEPROTL1; My047; UNQ577/PRO1139; Leptin receptor overlapping transcript-like 1; Endospanin-2 |
UniProt ID | O95214 |
◆ Recombinant Proteins | ||
LEPROTL1-416H | Recombinant Human LEPROTL1 Protein, MYC/DDK-tagged | +Inquiry |
LEPROTL1-2320R | Recombinant Rhesus Macaque LEPROTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LEPROTL1-9055M | Recombinant Mouse LEPROTL1 Protein | +Inquiry |
Leprotl1-3775M | Recombinant Mouse Leprotl1 Protein, Myc/DDK-tagged | +Inquiry |
LEPROTL1-1599H | Recombinant Human LEPROTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LEPROTL1 Products
Required fields are marked with *
My Review for All LEPROTL1 Products
Required fields are marked with *
0
Inquiry Basket