Recombinant Human LHB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LHB-2831H |
Product Overview : | LHB MS Standard C13 and N15-labeled recombinant protein (NP_000885) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. |
Molecular Mass : | 15.35 kDa |
AA Sequence : | MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LHB luteinizing hormone beta polypeptide [ Homo sapiens (human) ] |
Official Symbol | LHB |
Synonyms | LHB; luteinizing hormone beta polypeptide; lutropin subunit beta; CGB4; hLHB; interstitial cell stimulating hormone; beta chain; LSH B; luteinizing hormone beta subunit; lutropin; LSH-beta; lutropin beta chain; interstitial cell stimulating hormone, beta chain; LSH-B; |
Gene ID | 3972 |
mRNA Refseq | NM_000894 |
Protein Refseq | NP_000885 |
MIM | 152780 |
UniProt ID | P01229 |
◆ Recombinant Proteins | ||
LHB-7909H | Recombinant Human LHB protein, His & T7-tagged | +Inquiry |
Lhb-7910R | Recombinant Rat Lhb protein, His-tagged | +Inquiry |
LHB-2831H | Recombinant Human LHB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LHB-11657Z | Recombinant Zebrafish LHB | +Inquiry |
LHB-3173D | Recombinant Dog LHB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
LHB-840 | Native Luteinizing Hormone, beta Subunit | +Inquiry |
LHB-8212H | Native Luteinizing Beta Subunit Hormone | +Inquiry |
◆ Cell & Tissue Lysates | ||
LHB-1522HCL | Recombinant Human LHB Overexpression Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHB Products
Required fields are marked with *
My Review for All LHB Products
Required fields are marked with *