Recombinant Human LHB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LHB-2831H
Product Overview : LHB MS Standard C13 and N15-labeled recombinant protein (NP_000885) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene is a member of the glycoprotein hormone beta chain family and encodes the beta subunit of luteinizing hormone (LH). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LH is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism.
Molecular Mass : 15.35 kDa
AA Sequence : MEMLQGLLLLLLLSMGGAWASREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LHB luteinizing hormone beta polypeptide [ Homo sapiens (human) ]
Official Symbol LHB
Synonyms LHB; luteinizing hormone beta polypeptide; lutropin subunit beta; CGB4; hLHB; interstitial cell stimulating hormone; beta chain; LSH B; luteinizing hormone beta subunit; lutropin; LSH-beta; lutropin beta chain; interstitial cell stimulating hormone, beta chain; LSH-B;
Gene ID 3972
mRNA Refseq NM_000894
Protein Refseq NP_000885
MIM 152780
UniProt ID P01229

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LHB Products

Required fields are marked with *

My Review for All LHB Products

Required fields are marked with *

0
cart-icon
0
compare icon