Recombinant Human LHPP Protein (1-270 aa), His-tagged
| Cat.No. : | LHPP-1745H |
| Product Overview : | Recombinant Human LHPP Protein (1-270 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-270 aa |
| Description : | Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity) |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 31.2 kDa |
| AA Sequence : | MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVDNLAEAVDLLLQHADK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | LHPP phospholysine phosphohistidine inorganic pyrophosphate phosphatase [ Homo sapiens ] |
| Official Symbol | LHPP |
| Synonyms | LHPP; HDHD2B; hLHPP; FLJ44846; FLJ46044; MGC117251; MGC142189; MGC142191; |
| Gene ID | 64077 |
| mRNA Refseq | NM_001167880 |
| Protein Refseq | NP_001161352 |
| UniProt ID | Q9H008 |
| ◆ Recombinant Proteins | ||
| LHPP-202H | Recombinant Human MMRN2 protein, T7/His-tagged | +Inquiry |
| LHPP-1745H | Recombinant Human LHPP Protein (1-270 aa), His-tagged | +Inquiry |
| LHPP-5072M | Recombinant Mouse LHPP Protein, His (Fc)-Avi-tagged | +Inquiry |
| LHPP-9084M | Recombinant Mouse LHPP Protein | +Inquiry |
| LHPP-4820H | Recombinant Human LHPP protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LHPP-4753HCL | Recombinant Human LHPP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHPP Products
Required fields are marked with *
My Review for All LHPP Products
Required fields are marked with *



