Recombinant Human LOC442028 Protein, GST-tagged

Cat.No. : LOC442028-4782H
Product Overview : Human LOC442028 full-length ORF ( AAH42429.1, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LOC442028 (Uncharacterized LOC442028) is an RNA Gene, and is affiliated with the ncRNA class.
Molecular Mass : 47 kDa
AA Sequence : MNCGGGGSSSLRPQIPATQGCWHLQQLRFHMVAHEVGVLAALTALQVVSGDGEGHLCGVQGALQPLLLGQEQVGLRSQRLHLTLQLRLPAVRVLQSLAHCARGVLLRALRQRLGLCGQLLALVPLPLRLVAVGEGLVVASIAVLEPLLQQVLGGAEAGGGQAGGRVGARVTGHVVLFAGQLAGRHCLRHGACRPPGPGE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LOC442028 uncharacterized LOC442028 [ Homo sapiens (human) ]
Official Symbol LOC442028
Synonyms LOC442028; uncharacterized LOC442028;
Gene ID 442028

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LOC442028 Products

Required fields are marked with *

My Review for All LOC442028 Products

Required fields are marked with *

0
cart-icon
0
compare icon