Recombinant Human LOC645010 Protein, GST-tagged

Cat.No. : LOC645010-4251H
Product Overview : Human FLJ16126 full-length ORF ( ADR83468.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Molecular Mass : 14 kDa
AA Sequence : MDLHHSVQPESLLLSTASFSFSLIIPFNSNKMTWPAHENTEMRPHLVISGVLRGTLVVVLGAAVLSVKNFQEFLISCFHQDSHNLLLLPLSSGFVPEHIIRKAAIITAYLPPAPLHKHPPSPHCAKQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LOC645010 uncharacterized LOC645010 [ Homo sapiens (human) ]
Official Symbol LOC645010
Synonyms LOC645010; uncharacterized LOC645010; FLJ16126
Gene ID 645010

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LOC645010 Products

Required fields are marked with *

My Review for All LOC645010 Products

Required fields are marked with *

0
cart-icon
0
compare icon