Recombinant Human LOC645010 Protein, GST-tagged

• Cat.No.: LOC645010-4251H
• Product Overview: Human FLJ16126 full-length ORF ( ADR83468.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Molecular Mass: 14 kDa
• AA Sequence: MDLHHSVQPESLLLSTASFSFSLIIPFNSNKMTWPAHENTEMRPHLVISGVLRGTLVVVLGAAVLSVKNFQEFLISCFHQDSHNLLLLPLSSGFVPEHIIRKAAIITAYLPPAPLHKHPPSPHCAKQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LOC645010 uncharacterized LOC645010 [ Homo sapiens (human) ]
• Official Symbol: LOC645010
• Synonyms: LOC645010; uncharacterized LOC645010; FLJ16126
• Gene ID: 645010