Recombinant Human LOC645010 Protein, GST-tagged
Cat.No. : | LOC645010-4251H |
Product Overview : | Human FLJ16126 full-length ORF ( ADR83468.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Molecular Mass : | 14 kDa |
AA Sequence : | MDLHHSVQPESLLLSTASFSFSLIIPFNSNKMTWPAHENTEMRPHLVISGVLRGTLVVVLGAAVLSVKNFQEFLISCFHQDSHNLLLLPLSSGFVPEHIIRKAAIITAYLPPAPLHKHPPSPHCAKQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LOC645010 uncharacterized LOC645010 [ Homo sapiens (human) ] |
Official Symbol | LOC645010 |
Synonyms | LOC645010; uncharacterized LOC645010; FLJ16126 |
Gene ID | 645010 |
◆ Recombinant Proteins | ||
LOC645010-4251H | Recombinant Human LOC645010 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOC645010 Products
Required fields are marked with *
My Review for All LOC645010 Products
Required fields are marked with *