Recombinant Human LOX protein, T7/His-tagged
Cat.No. : | LOX-157H |
Product Overview : | Recombinant human LOX cDNA (169 - 417aa, Isoform-1, which derived from BC074872) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 169-417 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPD LVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWH SCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWI DITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | LOX lysyl oxidase [ Homo sapiens ] |
Official Symbol | LOX |
Synonyms | LOX; lysyl oxidase; protein-lysine 6-oxidase; MGC105112; |
Gene ID | 4015 |
mRNA Refseq | NM_001178102 |
Protein Refseq | NP_001171573 |
MIM | 153455 |
UniProt ID | P28300 |
Chromosome Location | 5q23.3-q31.2 |
Function | copper ion binding; metal ion binding; oxidoreductase activity; protein-lysine 6-oxidase activity; |
◆ Recombinant Proteins | ||
LOX-11818Z | Recombinant Zebrafish LOX | +Inquiry |
LOX-3180H | Recombinant Human LOX protein, His-SUMO & Myc-tagged | +Inquiry |
LOX-4450H | Recombinant Human FMOD (Met1-Trp26) and LOX (Ala22-Tyr417) Protein, N-TwinStrep tagged | +Inquiry |
Lox-1333M | Recombinant Mouse Lox Protein, MYC/DDK-tagged | +Inquiry |
LOX-2239H | Recombinant Human LOX protein, MBP&His-tagged | +Inquiry |
◆ Native Proteins | ||
LOX-41 | Active Native Lactate Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
LOX-4677HCL | Recombinant Human LOX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOX Products
Required fields are marked with *
My Review for All LOX Products
Required fields are marked with *