Recombinant Human LOX protein, T7/His-tagged

Cat.No. : LOX-157H
Product Overview : Recombinant human LOX cDNA (169 - 417aa, Isoform-1, which derived from BC074872) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 169-417 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFDDPYNPYKYSDDNPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPD LVADPYYIQASTYVQKMSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWH SCHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADIDCQWI DITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name LOX lysyl oxidase [ Homo sapiens ]
Official Symbol LOX
Synonyms LOX; lysyl oxidase; protein-lysine 6-oxidase; MGC105112;
Gene ID 4015
mRNA Refseq NM_001178102
Protein Refseq NP_001171573
MIM 153455
UniProt ID P28300
Chromosome Location 5q23.3-q31.2
Function copper ion binding; metal ion binding; oxidoreductase activity; protein-lysine 6-oxidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LOX Products

Required fields are marked with *

My Review for All LOX Products

Required fields are marked with *

0
cart-icon