Recombinant Human LPCAT2 protein, GST-tagged
Cat.No. : | LPCAT2-1886H |
Product Overview : | Recombinant Human LPCAT2 protein(340-544 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 340-544 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | EAGLVEFTKISRKLKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSDKKDD |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LPCAT2 lysophosphatidylcholine acyltransferase 2 [ Homo sapiens ] |
Official Symbol | LPCAT2 |
Synonyms | LPCAT2; lysophosphatidylcholine acyltransferase 2; acyltransferase like 1 , AYTL1; FLJ20481; LPCAT-2; LPC acyltransferase 2; acyltransferase like 1; acyltransferase-like 1; lysoPC acyltransferase 2; lyso-PAF acetyltransferase; acetyl-CoA:lyso-PAF acetyltransferase; 1-acylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; acyl-CoA:lysophosphatidylcholine acyltransferase 2; lyso-platelet-activating factor (PAF) acetyltransferase; acetyl-CoA:lyso-platelet-activating factor acetyltransferase; AYTL1; LysoPAFAT; DKFZp686H22112; |
Gene ID | 54947 |
mRNA Refseq | NM_017839 |
Protein Refseq | NP_060309 |
MIM | 612040 |
UniProt ID | Q7L5N7 |
◆ Recombinant Proteins | ||
LPCAT2-1886H | Recombinant Human LPCAT2 protein, GST-tagged | +Inquiry |
LPCAT2-5138M | Recombinant Mouse LPCAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LPCAT2-2281C | Recombinant Chicken LPCAT2 | +Inquiry |
Lpcat2-1743M | Recombinant Mouse Lpcat2 Protein, His&GST-tagged | +Inquiry |
LPCAT2-402C | Recombinant Cynomolgus Monkey LPCAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPCAT2-4671HCL | Recombinant Human LPCAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPCAT2 Products
Required fields are marked with *
My Review for All LPCAT2 Products
Required fields are marked with *