Recombinant Human LPCAT2 protein, GST-tagged
| Cat.No. : | LPCAT2-1886H |
| Product Overview : | Recombinant Human LPCAT2 protein(340-544 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 340-544 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | EAGLVEFTKISRKLKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSDKKDD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | LPCAT2 lysophosphatidylcholine acyltransferase 2 [ Homo sapiens ] |
| Official Symbol | LPCAT2 |
| Synonyms | LPCAT2; lysophosphatidylcholine acyltransferase 2; acyltransferase like 1 , AYTL1; FLJ20481; LPCAT-2; LPC acyltransferase 2; acyltransferase like 1; acyltransferase-like 1; lysoPC acyltransferase 2; lyso-PAF acetyltransferase; acetyl-CoA:lyso-PAF acetyltransferase; 1-acylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; acyl-CoA:lysophosphatidylcholine acyltransferase 2; lyso-platelet-activating factor (PAF) acetyltransferase; acetyl-CoA:lyso-platelet-activating factor acetyltransferase; AYTL1; LysoPAFAT; DKFZp686H22112; |
| Gene ID | 54947 |
| mRNA Refseq | NM_017839 |
| Protein Refseq | NP_060309 |
| MIM | 612040 |
| UniProt ID | Q7L5N7 |
| ◆ Recombinant Proteins | ||
| LPCAT2-4722H | Recombinant Human LPCAT2 Protein, GST-tagged | +Inquiry |
| LPCAT2-621H | Recombinant Human LPCAT2 protein, GST-tagged | +Inquiry |
| LPCAT2-2570H | Recombinant Human LPCAT2 protein, His-tagged | +Inquiry |
| RFL251RF | Recombinant Full Length Rat Lysophosphatidylcholine Acyltransferase 2(Lpcat2) Protein, His-Tagged | +Inquiry |
| LPCAT2-2281C | Recombinant Chicken LPCAT2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LPCAT2-4671HCL | Recombinant Human LPCAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPCAT2 Products
Required fields are marked with *
My Review for All LPCAT2 Products
Required fields are marked with *
