Recombinant Human LPCAT2 protein, His-tagged

Cat.No. : LPCAT2-2570H
Product Overview : Recombinant Human LPCAT2 protein(340-544 aa), fused to His tag, was expressed in E. coli.
Availability October 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 340-544 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : EAGLVEFTKISRKLKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVLRQLFALFDRNHDGSIDFREYVIGLAVLCNPSNTEEIIQVAFKLFDVDEDGYITEEEFSTILQASLGVPDLDVSGLFKEIAQGDSISYEEFKSFALKHPEYAKIFTTYLDLQTCHVFSLPKEVQTTPSTASNKVSPEKHEESTSDKKDD
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name LPCAT2 lysophosphatidylcholine acyltransferase 2 [ Homo sapiens ]
Official Symbol LPCAT2
Synonyms LPCAT2; lysophosphatidylcholine acyltransferase 2; acyltransferase like 1 , AYTL1; FLJ20481; LPCAT-2; LPC acyltransferase 2; acyltransferase like 1; acyltransferase-like 1; lysoPC acyltransferase 2; lyso-PAF acetyltransferase; acetyl-CoA:lyso-PAF acetyltransferase; 1-acylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; acyl-CoA:lysophosphatidylcholine acyltransferase 2; lyso-platelet-activating factor (PAF) acetyltransferase; acetyl-CoA:lyso-platelet-activating factor acetyltransferase; AYTL1; LysoPAFAT; DKFZp686H22112;
Gene ID 54947
mRNA Refseq NM_017839
Protein Refseq NP_060309
MIM 612040
UniProt ID Q7L5N7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LPCAT2 Products

Required fields are marked with *

My Review for All LPCAT2 Products

Required fields are marked with *

0
cart-icon
0
compare icon