Recombinant Human LRRC20 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LRRC20-2147H |
| Product Overview : | LRRC20 MS Standard C13 and N15-labeled recombinant protein (NP_997002) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | LRRC20 (Leucine Rich Repeat Containing 20) is a Protein Coding gene. |
| Molecular Mass : | 20.5 kDa |
| AA Sequence : | MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LRRC20 leucine rich repeat containing 20 [ Homo sapiens (human) ] |
| Official Symbol | LRRC20 |
| Synonyms | LRRC20; leucine rich repeat containing 20; leucine-rich repeat-containing protein 20; FLJ10751; FLJ10844; |
| Gene ID | 55222 |
| mRNA Refseq | NM_207119 |
| Protein Refseq | NP_997002 |
| UniProt ID | Q8TCA0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC20 Products
Required fields are marked with *
My Review for All LRRC20 Products
Required fields are marked with *



