Recombinant Human LRRFIP1 protein, GST-tagged
| Cat.No. : | LRRFIP1-646H |
| Product Overview : | Recombinant Human LRRFIP1 protein(1-105 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | July 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-105 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 [ Homo sapiens ] |
| Official Symbol | LRRFIP1 |
| Synonyms | LRRFIP1; leucine rich repeat (in FLII) interacting protein 1; leucine-rich repeat flightless-interacting protein 1; FLAP 1; FLIIAP1; GC binding factor 2; GCF 2; HUFI 1; TRIP; GC-binding factor 2; NEDD8-conjugating enzyme; TAR RNA-interacting protein; LRR FLII-interacting protein 1; GCF2; FLAP1; GCF-2; FLAP-1; HUFI-1; MGC10947; MGC119738; MGC119739; |
| Gene ID | 9208 |
| mRNA Refseq | NM_001137550 |
| Protein Refseq | NP_001131022 |
| MIM | 603256 |
| UniProt ID | Q32MZ4 |
| ◆ Recombinant Proteins | ||
| LRRFIP1-1556H | Recombinant Human LRRFIP1 protein, His-tagged | +Inquiry |
| LRRFIP1-4984H | Recombinant Human LRRFIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LRRFIP1-3346H | Recombinant Human LRRFIP1 protein, His-tagged | +Inquiry |
| LRRFIP1-4364H | Recombinant Human LRRFIP1 protein, His-tagged | +Inquiry |
| LRRFIP1-5208M | Recombinant Mouse LRRFIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LRRFIP1-4620HCL | Recombinant Human LRRFIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRFIP1 Products
Required fields are marked with *
My Review for All LRRFIP1 Products
Required fields are marked with *




