Recombinant Human LRRFIP1 protein, GST-tagged

• Cat.No.: LRRFIP1-646H
• Product Overview: Recombinant Human LRRFIP1 protein(1-105 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-105 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 [ Homo sapiens ]
• Official Symbol: LRRFIP1
• Synonyms: LRRFIP1; leucine rich repeat (in FLII) interacting protein 1; leucine-rich repeat flightless-interacting protein 1; FLAP 1; FLIIAP1; GC binding factor 2; GCF 2; HUFI 1; TRIP; GC-binding factor 2; NEDD8-conjugating enzyme; TAR RNA-interacting protein; LRR FLII-interacting protein 1; GCF2; FLAP1; GCF-2; FLAP-1; HUFI-1; MGC10947; MGC119738; MGC119739
• Gene ID: 9208
• mRNA Refseq: NM_001137550
• Protein Refseq: NP_001131022
• MIM: 603256
• UniProt ID: Q32MZ4