"LSAMP" Related Products

Expand
Expand

Recombinant Human LSAMP protein, T7/His-tagged

Cat.No.: LSAMP-152H
Product Overview: Recombinant human mature LSAMP cDNA (29 -315aa, derived from BC033803) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGH DKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVT LVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESK SNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTN ASLVLFRPGSVRGIN
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro LSAMP mediated neuronal connection regulation study for neurogenesis with this protein as either coating matrix protein or soluble factor.2. May be used for LSAMP protein-protein interaction assay.3. Potential diagnostic biomarker protein for various tumor and neuronal diseases.4. As antigen for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: LSAMP limbic system-associated membrane protein [ Homo sapiens ]
Official Symbol: LSAMP
Synonyms: LSAMP; limbic system-associated membrane protein; IgLON family member 3; IGLON3; LAMP; FLJ34254; FLJ35396; FLJ37216; FLJ54658;
Gene ID: 4045
mRNA Refseq: NM_002338
Protein Refseq: NP_002329
MIM: 603241
UniProt ID: Q13449
Chromosome Location: 3q13.2-q21
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.