Recombinant Human LSM8 Protein, GST-tagged

• Cat.No.: LSM8-4604H
• Product Overview: Human LSM8 full-length ORF (BAG34877.1, 1 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the LSm family and encodes a protein with a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. The protein partners with six paralogs to form a heteroheptameric ring which transiently binds RNAs and is involved in the general maturation of RNA in the nucleus. [provided by RefSeq
• Molecular Mass: 36.96 kDa
• AA Sequence: MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEPLNSVAH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LSM8 LSM8 homolog, U6 small nuclear RNA associated [ Homo sapiens (human) ]
• Official Symbol: LSM8
• Synonyms: LSM8; LSM8 homolog, U6 small nuclear RNA associated; NAA38; LSM8 homolog, U6 small nuclear RNA associated; LSM8 U6 small nuclear RNA associated; MAK31-like protein; N-alpha-acetyltransferase 38, NatC auxiliary subunit; U6 snRNA-associated Sm-like protein LSm8
• Gene ID: https://www.ncbi.nlm.nih.gov/gene/?term=51691
• mRNA Refseq: NM_016200
• Protein Refseq: NP_057284
• MIM: 607288
• UniProt ID: O95777