Recombinant Human LYG1 Protein, GST-tagged
| Cat.No. : | LYG1-4562H |
| Product Overview : | Human LYG1 full-length ORF ( NP_777558.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | LYG1 (Lysozyme G1) is a Protein Coding gene. GO annotations related to this gene include lysozyme activity. An important paralog of this gene is LYG2. |
| Molecular Mass : | 47.8 kDa |
| AA Sequence : | MSALWLLLGLLALMDLSESSNWGCYGNIQSLDTPGASCGIGRRHGLNYCGVRASERLAEIDMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTSWISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCNDVLARAKYLKRHGF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LYG1 lysozyme G-like 1 [ Homo sapiens ] |
| Official Symbol | LYG1 |
| Synonyms | LYG1; lysozyme G-like 1; lysozyme g-like protein 1; SALW1939; |
| Gene ID | 129530 |
| mRNA Refseq | NM_174898 |
| Protein Refseq | NP_777558 |
| UniProt ID | Q8N1E2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYG1 Products
Required fields are marked with *
My Review for All LYG1 Products
Required fields are marked with *




