Recombinant Human LYPD4 Protein, GST-tagged
| Cat.No. : | LYPD4-4553H |
| Product Overview : | Human LYPD4 full-length ORF ( AAH34629.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | LYPD4 (LY6/PLAUR Domain Containing 4) is a Protein Coding gene. Diseases associated with LYPD4 include Mitral Valve Insufficiency and Retinitis Pigmentosa 4, Autosomal Dominant Or Recessive. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins. An important paralog of this gene is CD177. |
| Molecular Mass : | 49 kDa |
| AA Sequence : | MGPQHLRLVQLFCLLGAISTLPRMSCGAGCYKTQKGTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTNLEPFVKLKASTPKSITSASCSCPTCVGEHMKDCLPNFVTTNSCPLAASTCYSSTLKFQAGFLNTTFLLMGCAREHNQLLADFHHIGSIKVTEVLNILEKSQIVGAASSRQDPAWGVVLGLLFAFRD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LYPD4 LY6/PLAUR domain containing 4 [ Homo sapiens ] |
| Official Symbol | LYPD4 |
| Synonyms | LYPD4; LY6/PLAUR domain containing 4; ly6/PLAUR domain-containing protein 4; MGC42718; sperm membrane receptor; SMR; |
| Gene ID | 147719 |
| mRNA Refseq | NM_173506 |
| Protein Refseq | NP_775777 |
| UniProt ID | Q6UWN0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPD4 Products
Required fields are marked with *
My Review for All LYPD4 Products
Required fields are marked with *



