Recombinant Human MAD2L1BP protein, T7-tagged
Cat.No. : | MAD2L1BP-160H |
Product Overview : | Recombinant human MAD2L1BP (274 aa, isoforms-II) fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 274 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGEFMAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVF PGPVSQEGCCQFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVSSRKCQQALAELESVL SHLEDFFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMG TVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | MAD2L1BP MAD2L1 binding protein [ Homo sapiens ] |
Official Symbol | MAD2L1BP |
Synonyms | MAD2L1BP; MAD2L1 binding protein; MAD2L1-binding protein; CMT2; dJ261G23.1; KIAA0110; caught by MAD2 protein; RP1-261G23.6; MGC11282; |
Gene ID | 9587 |
mRNA Refseq | NM_001003690 |
Protein Refseq | NP_001003690 |
MIM | |
UniProt ID | Q15013 |
Chromosome Location | 6p21.1 |
Function | protein binding; |
◆ Recombinant Proteins | ||
Mad2l1bp-3896M | Recombinant Mouse Mad2l1bp Protein, Myc/DDK-tagged | +Inquiry |
MAD2L1BP-5543H | Recombinant Human MAD2L1 Binding Protein, His-tagged | +Inquiry |
MAD2L1BP-5291M | Recombinant Mouse MAD2L1BP Protein, His (Fc)-Avi-tagged | +Inquiry |
MAD2L1BP-160H | Recombinant Human MAD2L1BP protein, T7-tagged | +Inquiry |
MAD2L1BP-2619R | Recombinant Rhesus monkey MAD2L1BP Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAD2L1BP-4569HCL | Recombinant Human MAD2L1BP 293 Cell Lysate | +Inquiry |
MAD2L1BP-4568HCL | Recombinant Human MAD2L1BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAD2L1BP Products
Required fields are marked with *
My Review for All MAD2L1BP Products
Required fields are marked with *
0
Inquiry Basket