Recombinant Human MAP4K3 protein, His-tagged
Cat.No. : | MAP4K3-738H |
Product Overview : | Recombinant Human MAP4K3 protein(537-873 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 537-873 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | KIHCASSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSISGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFSVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIDFPIPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 [ Homo sapiens ] |
Official Symbol | MAP4K3 |
Synonyms | MAP4K3; mitogen-activated protein kinase kinase kinase kinase 3; RAB8IPL1; GLK; MAPKKKK3; MEK kinase kinase 3; MAPK/ERK kinase kinase kinase 3; germinal center kinase-like kinase; germinal center kinase-related protein kinase; MEKKK 3; |
Gene ID | 8491 |
mRNA Refseq | NM_003618 |
Protein Refseq | NP_003609 |
MIM | 604921 |
UniProt ID | Q8IVH8 |
◆ Recombinant Proteins | ||
MAP4K3-01H | Recombinant Human MAP4K3 Protein, DYKDDDDK-tagged | +Inquiry |
MAP4K3-1301H | Recombinant Human MAP4K3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAP4K3-185H | Recombinant Human MAP4K3 protein, MYC/DDK-tagged | +Inquiry |
MAP4K3-392H | Active Recombinant Human MAP4K3 protein, GST-tagged | +Inquiry |
MAP4K3-728H | Recombinant Human MAP4K3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP4K3-4501HCL | Recombinant Human MAP4K3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP4K3 Products
Required fields are marked with *
My Review for All MAP4K3 Products
Required fields are marked with *