Recombinant Human MARCH8 protein, His-tagged
| Cat.No. : | MARCH8-3221H |
| Product Overview : | Recombinant Human MARCH8 protein(1-158 aa), fused to His tag, was expressed in E. coli. |
| Availability | June 11, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-158 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMCS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MARCH8 membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase [ Homo sapiens ] |
| Official Symbol | MARCH8 |
| Synonyms | MIR; c-MIR; RNF178; MARCH-VIII |
| Gene ID | 220972 |
| mRNA Refseq | NM_145021.4 |
| Protein Refseq | NP_659458.2 |
| MIM | 613335 |
| UniProt ID | Q5T0T0 |
| ◆ Recombinant Proteins | ||
| MARCH8-9561M | Recombinant Mouse MARCH8 Protein | +Inquiry |
| MARCH8-748H | Recombinant Human 41341, GST-tagged | +Inquiry |
| RFL11909XF | Recombinant Full Length Xenopus Laevis E3 Ubiquitin-Protein Ligase March8(41341) Protein, His-Tagged | +Inquiry |
| RFL36496MF | Recombinant Full Length Mouse E3 Ubiquitin-Protein Ligase March8(41341) Protein, His-Tagged | +Inquiry |
| MARCH8-5479C | Recombinant Chicken MARCH8 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MARCH8-4467HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
| MARCH8-4468HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
| MARCH8-4469HCL | Recombinant Human MARCH8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MARCH8 Products
Required fields are marked with *
My Review for All MARCH8 Products
Required fields are marked with *
