"MAX" Related Products

Expand
Expand
Expand

Recombinant Human MAX protein, GST-tagged

Cat.No.: MAX-176H
Product Overview: Recombinant Human MAX(1 a.a. - 151 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Mutations of this gene have been reported to be associated with hereditary pheochromocytoma. A pseudogene of this gene is located on the long arm of chromosome 7. Alternative splicing results in multiple transcript variants.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 42.35 kDa
AA Sequence: MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQD IDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEA S
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: MAX MYC associated factor X [ Homo sapiens ]
Official Symbol: MAX
Synonyms: MAX; MYC associated factor X; MAX protein; protein max; bHLHd4; bHLHd5; bHLHd6; bHLHd7; bHLHd8; helix-loop-helix zipper protein; class D basic helix-loop-helix protein 4; orf1; MGC10775; MGC11225; MGC18164; MGC34679; MGC36767;
Gene ID: 4149
mRNA Refseq: NM_002382
Protein Refseq: NP_002373
MIM: 154950
UniProt ID: P61244
Chromosome Location: 14q23
Pathway: C-MYC pathway, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Cyclin A:Cdk2-associated events at S phase entry, organism-specific biosystem; Cyclin E associated events during G1/S transition, organism-specific biosystem; G1/S Transition, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem;
Function: protein binding; protein complex binding; protein heterodimerization activity; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; transcription cofactor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.